PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf13533g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 317aa    MW: 35321 Da    PI: 6.5502
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf13533g01001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.8e-3947107262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               +++++kcprCdst+tkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+r nkk+s
  Niben101Scf13533g01001.1  47 HDHSIKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTEGGTLRNIPVGGGCRINKKVS 107
                               57889*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2941101IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3249105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.38851105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MDSSNWLQGT IHEEGAAGID SSSSPISEEI LTCSRPLIVE RRLRPPHDHS IKCPRCDSTH  60
TKFCYYNNYS LSQPRYFCKT CRRYWTEGGT LRNIPVGGGC RINKKVSSKK SNIETANNNQ  120
NPTDIQLSFP DQMPPFSHHH FMSSNNFGHG NHQGNNFMLE NHTPIDFMES KYEALVGTTT  180
SRNQDFLGNG DIGMISTPTG FGHEINSHGN IIPPNFAFGM TTMDAENNFG TTVMDSSHHH  240
QRLMLPNYEN NQHEEQINVS VDVKPNPKIL SLEWHDQVQG CSDAGKESFG YYSSVGGLGS  300
WTGLINSYGS SATNPLV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009765174.10.0PREDICTED: dof zinc finger protein DOF5.6-like
RefseqXP_016451922.10.0PREDICTED: dof zinc finger protein DOF5.6-like
TrEMBLA0A061FUJ41e-111A0A061FUJ4_THECC; F-box family protein isoform 2 (Fragment)
TrEMBLA0A061FV521e-111A0A061FV52_THECC; Dof-type zinc finger DNA-binding family protein isoform 1
STRINGVIT_17s0000g08290.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48952240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.14e-43Dof family protein